search
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to RECLAIMS-YARD
£0.00
Carron 4.7Kw Matt Black Cast Iron Multi-fuel Stove
Carron 4.7Kw Matt Black Cast Iron Multi-fuel Stove

Carron 4.7Kw Matt Black Cast Iron Multi-fuel Stove

£499.00 inc. tax
Description
Carron 4.7Kw Cast Iron Multi-fuel Stove in Matt Black Cast Iron Finish.

This is the smaller version of the Carron Multi-fuel Stove and the smallest Stove we stock.  It is almost identical in design but a much smaller size for those with limited space.

Please see Dimensions in Image.

Stove Pipe Also Available (5" Ø).

DEFRA Approved for Use in Smokeless Zones.
Delivery Time: Approx. 7-14 days

Please click for Full Brochure

Warranty

Carron Stoves are supplied with a 3 year stove body and 1 year inner components warranty.  This warranty does not cover items considered consumables. These items include door glass, fire bricks, fire rope and grates. The use of incorrect fuels would invalidate this warranty.

This appliance must be installed by a HETAS engineer. Proof of purchase and certificate of installation would be required in the case of a warranty claim.

Due to limitations of the printing process, colour reproduction of enamel stoves may vary slightly from those shown.

Please consult your local stockist for more accurate colour matching.

Occasionally the enamel finish can show a crazing/cracking effect on the surface of the stove during use. This effect will normally lessen as the stove cools and should not be considered a defect. This crazing effect can be made worse by incorrect fuel or over-fueling.

Details
Product Code: 47kwSEenStove
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
(write review)
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i